PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v4752710.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NF-YA
Protein Properties Length: 178aa    MW: 19376.8 Da    PI: 10.6916
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v4752710.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA97.91e-301166258
        CBFB_NFYA  2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
                      p+YVNaKQy++I++RRq+Rak+  ++k+ +k rkpylheSRh hAlrRpRg+gGrF
  Lj1g3v4752710.2 11 GPIYVNAKQYHGIIRRRQSRAKAVLDRKM-TKRRKPYLHESRHLHALRRPRGCGGRF 66
                     69**************************9.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.5E-34869IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115235.654969IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.3E-261266IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.3E-231234IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.3E-234366IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MLPLNLTTDE GPIYVNAKQY HGIIRRRQSR AKAVLDRKMT KRRKPYLHES RHLHALRRPR  60
GCGGRFLNTK VSANGNGKTG RDVKKTGGEQ LQSSGSQGSD VFQSEVGTLN SSKETNGSSP  120
NVSGLEVTSM YSRGGFDTFS FNHLGSSVYP LADMVDCGRG IMPTKWVAAG GNSCNLNT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-181070262NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12443RRRQSRAKAVLDRKMTKRRK
22444RRRQSRAKAVLDRKMTKRRKP
32544RRQSRAKAVLDRKMTKRRKP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.174430.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB3786280.0AB378628.1 Lotus japonicus CBF-A22 mRNA for transcription factor CCAAT, complete cds.
GenBankBT1376570.0BT137657.1 Lotus japonicus clone JCVI-FLLj-2D9 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004494259.18e-98PREDICTED: nuclear transcription factor Y subunit A-10-like
SwissprotQ9M9X48e-43NFYA2_ARATH; Nuclear transcription factor Y subunit A-2
TrEMBLI3SB101e-129I3SB10_LOTJA; Uncharacterized protein
STRINGGLYMA03G36140.42e-92(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05690.12e-39nuclear factor Y, subunit A2